PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC02G05520.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family bZIP
Protein Properties Length: 246aa    MW: 26248.6 Da    PI: 9.9794
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC02G05520.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_121.45.4e-071451872163
                      HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1  21 RqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                      R RKk+++ e ++ v +L  eN++L++e+  l+  + +l +e+
  OPUNC02G05520.1 145 RPRKKMRLPEVQQLVRSLAVENDSLREEMRALQRACTALSKEN 187
                      89*************************************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1705.7E-4145184No hitNo description
Sequence ? help Back to Top
Protein Sequence    Length: 246 aa     Download sequence    Send to blast
MDCAGDDDAV AADIICSLRG ADLAGWTPPW WCSSSGSKRA QREELIWPPV TRGKRSRRRS  60
PSAVVATAGK KRKWARASPV SPLDYSGGSG SGSGSVASTS GGEDGAFCSP PGHRPAPATT  120
KVGAMDRQQQ LPFLAPSPLL PAGQRPRKKM RLPEVQQLVR SLAVENDSLR EEMRALQRAC  180
TALSKENGKL EIRLEISSSR NKPIITEDLK GKQQIDQQSA TQSIGGGFSL PDLNIPVQDV  240
ADGSVH
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
15672RRRSPSAVVATAGKKRK
2144150RPRKKMR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1076300.0AK107630.1 Oryza sativa Japonica Group cDNA clone:002-131-E03, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015626239.11e-139PREDICTED: uncharacterized protein LOC4328519 isoform X1
TrEMBLA0A0E0JWG51e-178A0A0E0JWG5_ORYPU; Uncharacterized protein
STRINGORGLA02G0057900.11e-140(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP37902951